Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G080111-GRMZM2G336766
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):ocs element-binding factor 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.1224244431705
Log2 mRNA fold difference:-0.75343365156341
Log2 TE fold difference:-1.791694889039
Sequences
Protein sequence

MQQNWAADLACLPGLDLGSLFLPQNDDPMYDFSTFDMVDLDPYPCSCNGSVTTTTVSSVS
AAAADKHQERRGNDVERKKRRLASNRESARRSRVRKQRRLYELSLQVAELLGTNQRLLVE
LNHVTAKYALLARENAKLREEAAGLQRRLSEMELMGEAEAAALSPEVA*

MQQSCAAANLARLPLPVVPGLEDLASLFLPRNGPVLPAHDYSSSFDFDVVAGLDPAYYYY
PHSCDGGAAIATPVSSVSAERKRRRLASNRSSARRSRARRQRRLHELSLRAAELLGANQR
LLVDLNRVVARHGAVARENARLREEAAGLRTRLGEVEVGEAAAAAAAGQGPLRGPS*

Other information
Ka divergence:0.408505KaKs divergence:-0.167031
GC content 1 (%):57GC content 2 (%):68GC content divergence:0.088
Length 1 (bp):507Length 2 (bp):531Length divergence:0.023
MFE 1 (kcal):-182.09MFE 2 (kcal):-251MFE divergence0.159