Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G080487-GRMZM2G031338
Species:maize
Duplication type:WGD
Function (paralog1):loricrin
Function (paralog2):loricrin

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLNSGSCLAGGHDGNNDQPNGDGGGQQYEGTGGKKQLESSRLKKSSGNKDKADAAEDDYP
NPKYCTNNTSGGTSVAGAPYCVGVGVGGGGGGYGNSSRCGGGGDGDSYGNSCPYGTGGNA
PYNNAPAAFWAPQDGARSPLYINTQAVHVYGMPCVSNNDNSNDDDKRTKRGNGFFGPVFH
AAGHFLDRKFGFDGRD*

MWNSRSHFAGGQDNDGNDDQPYGYGYGGGQQYEATGGKKRASSRLKKSSGSKKDDEYTKY
AGNSNEADDNRRNRPNDDNNYNGGGGNHYSGAGAAIGAPYYGAAGAGGYGSSSPYYGNAA
VHGTGGDGGGGYAPYNNAPAAFWAPQDGTRSPMFISTREVHVYGAPGGYDNYDGSNNDDR
QRRRGGGGFFGPAFHAVGRFFDRKFGFSDRD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):65GC content divergence:0.024
Length 1 (bp):591Length 2 (bp):636Length divergence:0.037
MFE 1 (kcal):-252.97MFE 2 (kcal):-265.8MFE divergence0.025