Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G080583-GRMZM2G163157
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):6b-interacting protein 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.54940496140737
Log2 mRNA fold difference:0.72310151132766
Log2 TE fold difference:-0.19149575061934
Sequences
Protein sequence

MDGKLPPPNPNLPYREDCWSEGETAALVDAWGSRYLDLNRGSLRQPQWREVADAVNSRPG
ASARRRPPRTDIQCKNRVDTLKKKYKAERARGGPSQWNFYAQLDLLVGPTLTGIKKPSPP
RAALPVFRRRLTPPRSPSPQSPPPLPVALPLHNYRRGSDLPSANLIHKAAAAAAAAAAES
DSEDGYNNNDYDDDEGSQQSPSRSVSSGFGGGGGGAPPAVGSKRKMSSGSGGFGELARAI
ETFADMYERMEAAKQQHAEEMERQRIKFLKDLELKRMQAFVDMQLQLARTKHARKGDASS
DTLMSLAALPFLSSPAYL*

MDGKLPPPNPNLPYREDCWSEGETAALVDAWGSRYLDLNRGSLRQPQWREVADAVNSRPG
ASARGRPPRTDIQCKNRVDTLKKKYKAERARGGPSPWSFYGQLDILVGPTLNGTKKPSPP
RAALPVFRRRQTPPRSPSPQSPPPLPVALPLHNYRRGSDLPSANFIHKAAAAAAAAAAAA
ESDSEDGYNNNEYDDDEGSQQSPSRSVSSRSGGAPAVGTKRKRRSGSGGFGELARAIETF
ADMYERMEAAKQRHAEEMERQRIKFLKDLELKRMRSFVDMQLQLSRAKHARKGDASSEML
MSLAALPFLSSSAYL*

Other information
Ka divergence:-0.0497772KaKs divergence:-0.152595
GC content 1 (%):65GC content 2 (%):67GC content divergence:0.015
Length 1 (bp):957Length 2 (bp):948Length divergence:-0.005
MFE 1 (kcal):-424.99MFE 2 (kcal):-438.93MFE divergence0.016