Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G080775-GRMZM2G115855
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191477
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.437910227841
Log2 mRNA fold difference:-1.6881127071115
Log2 TE fold difference:0.30289063611013
Sequences
Protein sequence

MALRHLVTGQNNCVPDGASSSNPLNALANAFLGQSSKAQSIKELPGSVNVPSTSDFSVSA
PLSNIPGSENEFKQDQRPLARGADFIRGGPANDWIESFRPPRVPQLGVEAQFPDFEQIYN
NAGTTFQFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQCIRDRS
CIMARHIFSDQPEEYIQSQVNTLLHSLDIDNRMRGPMHGQYPELQEYWKQSQSSTRPAPM
HNAADKWITEFGKQNNNPENWANSFEQQYGPNGWASEFEQHQSQMAMRQMGGANMANLAA
MEQSRVLAQTLASNNDPKFQNSKFFQFVSKMSRGELIIEDNQVKEGSASQSSGWADEFQT
PYIANANSWADQFAHEELSQGADKWVSEFSSQPNHGALNENWVDEFSKLNVTDEWAEEFS
GGGFGESSADPWVDEFQEHLSSFKQSPGASRGVYVFSENNPYVGHPNPMQEGQELFRKGL
LSEAVLALEAEVLKNPDNTEGWRLLGVTHAENDDDQQAIAAMMRALEANPTNLEVLLALG
VSHTNELEQGEALRYLYRWLQNQPKYGGLVPLQSTDSPYGPDVVRLFNEAAQMSPEDADV
HIVLGVLYNLSREYDKAIASFKTALQLKPQDYSLWNKLGATQANSIQSADAILAYQQALD
LKPNYVRAWANMGISYANQGLYEDSIRYYVRAVAMNPKADNAWQYLRISLSNASRADMIA
ACDARNLDALQKEFPL*

MALRHLVTGQNNCAPDGASSSNPLNALANAFLGQSSKAQSIKELPGSVSVPSTSGFSAPA
PLSNIPGSENEFKQDQRPFVQSFRPPGVPELGGIEAHFPDFEQIYNNAGTTFQPPLDGPP
QRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQCIRDRSCIMARHIFSDQPEEYI
QAQVNTLLHSLDIDNRMRGPMHGQYPELQEYWNQSQSSMGPALMHNTADKWITEFGKQNN
NPENWAKSFEQQYGPNGWASEFEQHQSQMAMGQMGGVNMANLAAMEQSRMLAQTLASNND
PKFQNSKFFQFVSKMSRGELIIEDNQVKEGLASQSSGWADEFQTQYKANANSWADQFARE
ELSQGADKWVSEFSSQHNQGALNESWVDEFSKLNVTDEWAEEFSGGGFGESSADPWVDEF
QEHLSSFKQSSGASRGVYVYSENNPYVGHPNPMQEGQELFRKGLLSEAVLALEAEVLKNP
DNAEGWRLLGITHAENDDDQQAIAAMMRALEANPTNLEVLLALGVSHTNELEQGEALRYL
YRWLQNHPKYGGLVPPQSTDSPYGPDVVRLFNDAAQMSPEDADVHVVLGVLYNLSREYDK
AITSFKTAVQLKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISY
ANQGLYEDSIRYYVRAVTMNPKADNAWQYLRISLGNASRADMIAACDARNLDALQKEFPL
*

www.000webhost.com

Other information
Ka divergence:-0.0176331KaKs divergence:-0.039525
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2211Length 2 (bp):2163Length divergence:-0.011
MFE 1 (kcal):-713.35MFE 2 (kcal):-687.89MFE divergence-0.018