Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G080917-GRMZM2G172001
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284916
Function (paralog2):PHD finger protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.067852064767818
Log2 mRNA fold difference:0.26918355978868
Log2 TE fold difference:-0.37189799490193
Sequences
Protein sequence

MDGGGSGPAPNAAHTAEEVFRDYKARRAGMIKALTTDVERFFKLCDPEKENLCLYGYPDE
TWEVTLPAEEVPPEIPEPALGINFARDGMNEKDWLALVAVHSDSWLLSVAFYFGARFGFD
REARRRLFSLINNMPTIFEVVTGAVKKQQAKEKTPNSSSKSNKPSSKVQSRAESRSKAKV
PKDEEESGDDDGDEEAEEHDNTLCGTCGTNDGKDQFWICCDNCEKWYHGKCVKITPARAE
HIKQYKCPDCTNKRVRA*

MNGGGSGLAPNAAHTADEVFRDYKGRRAGMIKALTTDVERFFKLCDPGECARSLWFLAPG
CGVIAEEASVVFLLGLRCFEKENLCLYGYPDETWEVTLPAEEVPPEIPEPALGINFARDG
MNEKDWLALVAVHSDSWLLSVAFYFGARFGFDRETRRRLFSLINNMPTIFEVVTGAAKKQ
AKEKTPNSSSKSNRPSSKVQSRAESRSKAKVPQDEEESGDDDEDEEADEHNNTLCGTCGT
NDSKDQFWICCDNCEKWYHGKCVKITPARAEHIKQYKCPDCTNKRARA*

Other information
Ka divergence:0.696207KaKs divergence:0.640479
GC content 1 (%):56GC content 2 (%):53GC content divergence:-0.028
Length 1 (bp):774Length 2 (bp):867Length divergence:0.057
MFE 1 (kcal):-276.77MFE 2 (kcal):-304.59MFE divergence0.048