Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G080992-GRMZM2G006212
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384534
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTSCSGNATVACRDDAQPHGDAPCVIVYPLLAKTGEVHIPVAGDEAPAVPVLTSKSPGRL
ATAVKEALSVSLGAAFPMTPLVSSSDAHAEARSILGLALPMILTGLLLYLRSMISMLFLG
RLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAGNFSLLGITMQRTVLLLI
AAAVPIGGLWMHMRPLLLLCGQDAGIAAVAETYILASLPDLVLQAFIHPVRIYLRAQSIN
LPLTVCAALAIVIHLPINYVLVTVLGLGIRGVAFASVLANLNLLLFLVAYILFKSVHKRT
GGFLLSRESFRGWGELVSLALPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQT
TSLIYIFPSSLSFGVSTRVSNELGANRPEEASRAAAVGLMLGFAFGGLASAFAFLVRNVW
ASMFTADPAIIALTASVLPILGLCELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGT
PVALVLAFWLHYDFKGLWLGLLAAQATCMVRMLLVIGRTDWACEAKRSRQLTGGLVAEDS
DDKAGGDEKSRLLGDTDIEQANAHSDRC*

MTSCAGDATVACRDDARRLGDAACVIVYPLLDKAAEVHIPVAGDEAPAVPVPVLTSKSPG
RLATAVREALSVSLGVAFPTTPLVSSSEARGEARSILGLALPMILTGLLLYLRSMISMLF
LGRLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAGNFPLLGVTTQRTVLL
LVAAAVPIGGLWMHMRPLLLLCGQDTGIASVAETYILASLPDLVLQAFIHPVRIYLRAQS
INLPLTVCAALAIAIHLPVNYVLVTVLGLGIRGVAFASVLANLNLLLFLLAYILFRGVHR
RTGGFVLSRESFRGWGELVSLALPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILI
QTTSLIYIFPSSLSFGVSTRVSNELGANRPEEASRAAAVGLVLGFASGGLASAFAFLVRN
VWASMFTADPAIVALTASVLPILGLCELGNCPQTTGCGVLRGSARPKDAASINLRSFYLV
GTPVALVLAFWLHYDFKGLWFGLLAAQATCMVRMLLVIGRTDWACEAKRSRELTGAGGAV
AKDSDVKAGGDEKSRLLFYTDMEQANAHSADQC*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):1707Length 2 (bp):1722Length divergence:0.004
MFE 1 (kcal):-839.8MFE 2 (kcal):-842.21MFE divergence0.001