Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081090-GRMZM2G145158
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100303797

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.8940103409391
Log2 mRNA fold difference:-3.3354491972147
Log2 TE fold difference:0.49191793619999
Sequences
Protein sequence

MDPISIDKIRAMNKYSKGRRRQPQLLPTLSLYFYLAVATFVLCLLLTSPAWFPGLCSALA
SSFLTTLPGLFTAFLLSPRCLFVVGNLIIAFLVGESRLAPRRRDDDAQPSLVNEIHEEHV
KNNAAVADHSSFVGAVVGKEVQVQVQVKEEEEQEEEEEEGNEEELHTRVEDFIARVKRQR
KLELKSFFDVDR*

MDPISMEQVRAMNKYRKSRRQPHLPTLYMAVTFVLCLLLTSPAWFPRMCSALGFFFLTTV
PDLVTAFLLSPKCLFVVGNLIVAFLVGESRLAPRRGDDDDDRPSLVNEIHEEHMKKNAAL
TAATAAAAAQADHSAFVGAVGKRVEVKEEEEELHKRVEDFIARVKKQRKLELKSFFDVDR
*

Other information
Ka divergence:-0.207746KaKs divergence:-0.528611
GC content 1 (%):59GC content 2 (%):59GC content divergence:0
Length 1 (bp):579Length 2 (bp):543Length divergence:-0.032
MFE 1 (kcal):-248.7MFE 2 (kcal):-222.41MFE divergence-0.056