Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081102-GRMZM2G145280
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273645
Function (paralog2):60S ribosomal protein L13-2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4698895989776
Log2 mRNA fold difference:1.3636830613544
Log2 TE fold difference:0.098061362621142
Sequences
Protein sequence

MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC
QTLKYNMKSRAGRGFTLEELKAAGIPKRLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK
AKLVIFPRRARKVKAGDSTLEELTTATQVQGDYMPITRGEKRSVEVVKVTDEMKAFAAYG
KLRLERMNKKHLGARQKKAAEAEKEDKK*

MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC
QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK
AKLVIFPRRAHKVKAGDSTPEELATATQVQGDYMPFTRGEKRSVEVVKVTDEMKSFAAYG
KLRLERMNKKHLGARQKKAAEAEKEDKK*

Other information
Ka divergence:-0.412127KaKs divergence:-0.418014
GC content 1 (%):54GC content 2 (%):52GC content divergence:-0.019
Length 1 (bp):627Length 2 (bp):627Length divergence:0
MFE 1 (kcal):-217.5MFE 2 (kcal):-211MFE divergence-0.015