Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081515-GRMZM2G034385
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304411
Function (paralog2):hypothetical protein LOC100217086

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDLVPQLDSPHSDNGGGGGSGSLASGALSPGASSAGTVSALASPSRYESQKRRDWNTFGQ
YLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTAACPFFGHPAPPAPCPCPLRQAWG
SLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVRDHQSRARGVSYEKKKKRKKAPP
HPVPAAVISSSHDGNGHHYEHQMPPPPPPGAAA*

MDLVPHPDSPHSDNSGGGGGSASGALSPGASSAGAASALASPSRYESQKRRDWNTFGQYL
RNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTPACPFFGHPAPPAPCPCPLRQAWGSL
DALVGRLRAAYEENGGRPENNPFGARAVRLYLREVRDHQSRARGVSYEKKKRKKAPAHPV
PAAVISSSHDGNGHHYEHQMPPPPPPGAAA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):72GC content 2 (%):75GC content divergence:0.02
Length 1 (bp):642Length 2 (bp):633Length divergence:-0.007
MFE 1 (kcal):-323.19MFE 2 (kcal):-347.86MFE divergence0.037