Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081652-GRMZM2G033649
Species:maize
Duplication type:WGD
Function (paralog1):patellin-1 (LOC100284590), mRNA
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAEETQPEAAAAAAPAAAEVVVTEAAPAEAEVPVAAEAEAEAKDEKKGDEAELTADDAGV
GTGSFKEESNLVEDLPDPEKKALDEFKQLIAAALAAGEFNLPPPPPPPKAKETKVEEAKA
EEPAKEEPAAEAEATAEEPKAQVAADAPVEEVKTEVPPAEEAKAETLAEEAKPSEPEPQE
KTVVVTEEETATKTVEAIEETVVSAPAAIPEEAAAPEAVVEAQATAPEPVLIWGVPLVGD
DERTDTVLLKFLRAREFKVKDAMAMLKSAVLWRKRFGITSLLDADLGLTELENVVFYRGT
DREGHPVCYNVYGEFQDKDLYEKAFGDDEKRERFLKWRIQLLERGILSKLDFSPSGICSM
VQVTDLKNSPPMLGKHRAVTRQAVTLLQDNYPEFIAKKVFINVPWWYLAANKMMSPFLTQ
RTKSKFVFASPAKSAATLFRYIAPEQVPVQFGGLFKEDDPEFTTSDTVSELTIKPSSKET
VEIPVTENSTIVWELRVLSWEVSYGAEFTPDAEGGYTVIVQKTRKVPANEEPIMKGSFKA
GEPGKLVLTVNNPASKKKTLLYRSKVKSTSE*

MAEETQPEAAAEAEVVVTEPAPAPAEAEVPAAADAEAVTETEKKADEPAVTADDAGKGTG
SFKEESNLVEDLPDPEKKVLDEFKHLIAAALAAGEFNLPPPPPPPKAKEEPKAEETKTEE
SKTEDPAEEEPKAESAAEEPKAEVAANAPDEEVKTEVPPVEEAKAETVAVEAKPAEPEPQ
EKTVVVAEEEPATKTVEAIEESVVSADEAAAPEPVLVWGVPLVGDDERTDTVLLKFLRAR
EFKVKEAMAMLKSAVLWRKRFGITSLLDADLGLPELENVVFYRGADREGHPVCYNVYGEF
QDKDLYEKAFGDDEKRERFLKWRIQLLERGILSKLDFSPNGICSMVQVTDLKNSPPMLGK
HRAVTRQAVTLLQDNYPEFIAKKVFINVPWWYLAANKMMSPFFTQRTKSKFVFASPAKSA
ETLFRYIAPEQVPVQFGGLFKEDDPEFTTLDTVTELTIKPSSKETIEIPVTENSAIVWEL
RVLGWEVSYSAEFTPDTEGGYTVIIQKTRKVPANEEPIMKGSFKVGEPGKLVLTVNNPAS
KKKKLLYRSKVKSISE*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):1716Length 2 (bp):1671Length divergence:-0.013
MFE 1 (kcal):-749.3MFE 2 (kcal):-706.6MFE divergence-0.029