Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081682-GRMZM2G005493
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194128
Function (paralog2):hypothetical protein LOC100194385

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MIAGPNKLPPEPPHRICFIAFISSHIFILEKKTLFNHPPSSAALSSALFQVQQRLGTRRH
RRLPRERVSWSTKAGMKGCSERLLFLLLLLASSSLLSAVIAAQQTCPADLDSKCDGGASD
DDWEGEFFPGVPKIKYEGPTSKNPLAYKWYNKEEVILGKKMKDWMRFSVAFWHTFRGTGA
DPFGAPTKTWPWEDGTNSLAMAKRRMRAHFEFMEKLGVDKWCFHDRDIAPDGKTLEETNS
NLDEIVQLAKQLQGETNIKPLWGTAQLFMHPRYMHGAATSPEVKVYAYAAAQVKKALEVT
HYLGGENYVFWGGREGYQTLLNTDMKRELDHLANFLQAAVDYKKKIGFNGTLLIEPKPQE
PTKHQYDWDVATTFAFLQKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNIDA
NTGDPQVGWDTDQFMTDIAEATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLAHI
SGMDTLARGLRNVAKLIGDGSLDDLVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEWGE
PTVASGKQELAEILFQSAL*

MKGCSERLLLLLLLASSLLLSVVVAAQQTCPADLDSKCDGGAPDDWEGEFFPGVPKIKYE
GPTSKNPLAYKWYNKEEVILGKKMKDWMRFSVAFWHTFRGTGADPFGAPTKVWPWEDGTN
SLAMAKRRMRAHFEFMEKLGVDKWCFHDRDIAPDGKTLEETNANLDEIVELAKQLQGETN
IKPLWGTAQLFMHPRYMHGAATSPEVKVYAYAAAQVKKALEVTHYLGGENYVFWGGREGY
QTLLNTDLKRELDHLANFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFAFL
QKYGLTGEFKINVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDQFMTD
IAEATLVMSTVVKNGGLAPGGFNFDAKLRRESTDVEDLFLAHISGMDTLARGLRNAAKLI
EDGSLDALVRKRYQSFDSEIGALIEAGKGDFEALEKKVLEWGEPTVPSGKQELAEILFHS
AL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1680Length 2 (bp):1449Length divergence:-0.074
MFE 1 (kcal):-563.25MFE 2 (kcal):-506.76MFE divergence-0.053