Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081816-GRMZM2G164341
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192921
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.3088738211343
Log2 mRNA fold difference:1.4320800501436
Log2 TE fold difference:-0.11062751725529
Sequences
Protein sequence

MDHNLSDMTILSEHAWGDEAGAVLLSPPEVGSVIEGGGGMTVLERLVLDEALAAAILELQ
AIQQAAPGPASCAGKQQLAAGGGGGVVGAEAAVAFPSMMAMAMAAPTPAYADADVDAGVL
QRQQHHHRPHAAMGMPSPDYDLAPAAAATPAVAVTAAAPPAFTTNTNAAVDSGCSGLVVL
GRSPPPPVFSASNETAATASLDCEHGGGGRGGGRRQRRPNRKRKAAAEAERSRPVRVAAA
AAQEESTLCSLLASTAPTTAGGIQIAFSTAAVHQQQHAAGGAGGAKTSAKPSSLSLSSSG
SSSNISFDGRNPARNGGGGGGGDPVYEPDTEALAQVKEMIYRAAAMRPVSLGSEDDAGAG
AERPPRRRNVRISSDPQTVAARQRRERISDRLRVLQKLVPGGAKMDTASMLDEAASYLRF
LKSQVRDLQTLDRRNYGAASSNDAAATMAAVVGSSLSYNRGTGAMPAFTFPAAGETLRGA
G*

MDHNFSDMISSESAWSGGVGAGDGAGSGMTVLERLVLDEALAAAILELQGIQQAPACAGK
EVVMVAEPTAGGGVVGEAAVAFPSMGMATPTPAYADVDADVLQRQQHHHRHHGAMGMPPD
YDLTPATPAVTVTAVPPAFTSAAAYSGGNFVVGQSPAVFSTSNETTATAAAVTSTTSLNC
EQGGGGGGGRRQRRANRKRKAAAERSPVAAAQESTLCSLLASTTTAGEGGIQIAFSNAAA
AAKRSAKPSSLSSSGSSSISFDGRNPETNCGGVDDPMYEPDTEALAQVKEMIYRAAAMRP
VSLGSEEDAGERPRRRNVRISSDPQTVAARQRRERISERLRVLQKLVPGGAKMDTASMLD
EAASYLRFLQSQVRELQTLDRRNYGLTTADNNASRATATMAASGPLMSYNNGHGALPAFT
FPAAAGETLY*

Other information
Ka divergence:-0.226694KaKs divergence:-0.0687174
GC content 1 (%):70GC content 2 (%):68GC content divergence:-0.014
Length 1 (bp):1446Length 2 (bp):1293Length divergence:-0.056
MFE 1 (kcal):-769.6MFE 2 (kcal):-667.6MFE divergence-0.071