Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081822-GRMZM2G037146
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383047
Function (paralog2):hypothetical protein LOC100382094

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MANNRTYEEHTPAVEWSRSAAEADAVKISLPGFKREDLRVLVDNHGHLRTRGERHLTGNR
WIRFQNDFELPANCNADGIRAKFENETLTITLPKKTPSTPMQPPPRMPTAAPPPLQGQGQ
GLPPAARPAAPTPAPLAPAAPSVKPPAESRASMPRKTYDPVPAPAPEVEPPATTKPQPSL
GAVQRLKEEEEERKREEEGKMAEDRKEMVHEKDTQQEQQPMLAETMALANLKPRQASARQ
GMLVSVAVAVVVLLGFTVYVWHSLRNATGGAGGEHGHGHQLWTGSYGDEM*

MANNRIFDEYNPAVEWSRSDEADAVRISLPGFKREDIRVLVDSHGHLRTRGERHIAGNRW
SRFQTDVDLPANCNADGIRAKFENDRLTITLPKSTSSAPIPAPPQRPHVKAPSTSSERLP
PVIAKPVARPAAPRPLVPPAAPLAPPPSVKPPAEPRPSMPKNPYASVPAPAPAPAPAPQV
EQPATTTKPAEPRPSMPKNPYASVPAPAPAPAPAPQVEQPATTTKPAESSLGAVQRPKEQ
EDRQRKREEEGKMAEDRKETVQEKDTVTEQHQQQEEKAMLAEKEMAFANQPGPAFASRGL
LMNVAIAVVVLLGVTVHLWLSLRNATGGAGEHGHGPRADGGR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):68GC content 2 (%):69GC content divergence:0.007
Length 1 (bp):873Length 2 (bp):1029Length divergence:0.082
MFE 1 (kcal):-396.7MFE 2 (kcal):-493.15MFE divergence0.108