Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081826-GRMZM2G144742
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278609
Function (paralog2):hypothetical protein LOC100193062

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.57219985533357
Log2 mRNA fold difference:-1.8047746556989
Log2 TE fold difference:1.2874981448303
Sequences
Protein sequence

MACSTNLCFSASIPPLPASSSSSVSSPFLTVERVSYVPSLSRWTIRYKQLGHAYQRSHVL
AFASADASQGKRSSGENVVMVDPLEAKRLAAKQMQEIRAKEKLKRRSQAEAINGPLAMIG
LTAGLIVEAQTGKGILGQLAGYLTAISSLFGQ*

MACSTGLCFLASIPPLSASCSSGSSCFLMIKRVSSAPSLSRWTIQYKQLGHTIYRRSHVL
AFASADAPQGKRSSGENVVMVDPLEAKRLAAKQMQEIRAKEKLKRRRQAEAINGALAVIG
LTAGLLVEAQTGKDILGQLAGYLTAISSLFGQ*

Other information
Ka divergence:-0.292738KaKs divergence:-0.228662
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):459Length 2 (bp):459Length divergence:0
MFE 1 (kcal):-140.7MFE 2 (kcal):-147.56MFE divergence0.024