Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081924-GRMZM2G142984
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276743
Function (paralog2):hypothetical protein LOC100273227

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.340018579365
Log2 mRNA fold difference:1.5308270858488
Log2 TE fold difference:-1.2243749545601
Sequences
Protein sequence

MASASHQSEPLDSAATSDTDAPSDNIPELPCPPCHIVTKPGQLPVEFLEPSAAQKLVIGF
DCEGVDLCRNGALCIMQLAFPDAVYLVDAIEGGKELIQACKPALESDHITKVIHDCKRDS
EALYFQFGIKLHNVMDTQIAYSLIQEQEQKGKKKTSDDYNYISFVSLLADKRYCGIPYPE
KEEVRILLRQDPNFWTIRPLSDMMVRAATDDVRFLLNIYEKMMEKLNKVSLWRLAVRSEL
YCRCFCLNDNQFADWSPLPPVPDGIEADVYVPEVDILSVLDVPHGKMGRVIGRKGSTIMV
VKESCNVEIHIGGAKGPPDRVFIIGSVNEVRKAEAIFRGRMLEF*

MASHHSEPLDPADADDPSDNNPELPCPSYHIVTKPGQLPVEFLEPSAAQKLVIGFDCEGV
DLCRNGALCIMQLAFPDAVYLVDAIEGGKELIQACKPALESDHITKVIHDCKRDSEALYF
QFGIKLHNVMDTQIAYSLIEEQEQEGKKMTSDDYNYISFVSLLADKRYCGILYPEKEEVR
TLLRQDPNFWTIRPLSDMMVRAATDDVRFLLSIYAKMMEKLSKVSLWRLAVRSELYCRCF
CLSDNQFADWSPLPPVPDDIEADVYVPEADILSVLDVPPGKMGRVIGRKGSTIMAVKECC
KVEIHIGGAKGPPDRVFIIGPEKEVRKAEAIFRGRMLEF*

Other information
Ka divergence:-0.159242KaKs divergence:0.106643
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1035Length 2 (bp):1020Length divergence:-0.007
MFE 1 (kcal):-308.19MFE 2 (kcal):-306.7MFE divergence-0.002