Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G081949-GRMZM2G099239
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284456 (pco127157), mRNA
Function (paralog2):hypothetical protein LOC100192691

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.11597141322233
Log2 mRNA fold difference:0.24658265733579
Log2 TE fold difference:-0.36112802391599
Sequences
Protein sequence

MLSEQTAASTSSSGGGVERQDRWLQPVAENEEEEEEFRDIHALSPPPSQPSSYRRARGGE
PWGSAAGGSRHTSVRSVGSDTAPSEPFPTMTREFSAMVAAAASAAADSRDAGSDVVGRAE
EEEEEELEETNPLAIVPDSNPIPSPRRGPPPAAPGADAAALVAADGHGSREGGGVSVGQV
RKEEVESKIAAWQVAEVAKVNNRFKREEVVINGWEGDQVEKASAWLKKYEVINIHGSIAS
KPSKPPLIMYLDCPVLISSVLLCCMAQRKLEEKRAKAMEKAQNEVAKARRKAEEKRASAE
AKRGTKVARVLELANFMRAVGRAPSTKRSFF*

MLSEQTAASTSSGEHQERSVVEDRRLQPVGENEEAEFRDIHALSPPPSQPSSYRRSRHAS
VGSDTASSEPFPTMSREFSAMVAAAAAIANGAAADRLGEAEDEETNPLAIVPDSNPIPSP
RRARGPPTPGAGAAHANGDGGVSVGQVRKEEVESKIAAWQIAEVAKVNNRFKREEVVING
WEGDQVEKAGAWLNKYEVVSPSHRSTPPHSLTSVVRTVQCLLTDTNACNVQRKLEEKRAK
AMEKAQNEVARARHKAEAKRASAEAKRGTKVARVLELANFMRAVGRAPSAKRSFF*

Other information
Ka divergence:0.275124KaKs divergence:-0.0602496
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):996Length 2 (bp):888Length divergence:-0.057
MFE 1 (kcal):-470.7MFE 2 (kcal):-413.5MFE divergence-0.065