Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G082174-GRMZM2G178169
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217199
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.93789606470535
Log2 mRNA fold difference:-1.3392767933224
Log2 TE fold difference:2.2771569799495
Sequences
Protein sequence

MPPGSATQFRYTQTPSKVLHLRNMPWECTEEELVDLCKPFGRVVNTMCNVGANRNQAFVE
FADQNQAISMVSYYASSSEPAQVRGKTVYIQYSNRQEITNNKGTGDSSGNVLLVTFEGVQ
PNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNSLDGRSIPKYLL
PEHIGACHMRITFSAHKDLNIKFQSHRSRDYTNPYLPVNQTAIEGIVQPTVGPDGKVKEP
ESNVLLASIENMQYAVTVDVLHTVFSAFGAVQKIAMFEKNGGMQALIQYPDITTAAVAKQ
ALEGHCIYDGGYCT*

MPSGSATQFRYTQTPSKVLHLRNMPWECTEEELVELCKPFGRVVNTMCNVGANRNQAFVE
FADQNQAISMVSYYASSSEPAQVRGKTVYIQYSNRQEITNNKGTGDSSGNVLLVTFEGVQ
PNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNSLDGRSIPKYLL
PEHISACHMRITFSAHKDLNIKFQSHRSRDYTNPYLPVNQTAIEGIVQPTVGPDGKIKEP
ESNVLLASIENMQYAVTVDVLHTVFSAFGAVQKIAMFEKNGGMQALIQYPDITTAAVAKQ
ALEGHCIYDGGYCKLHLSYSRHTDLNVKAHDDRSRDYTLSDPNAQLQAAAQAPVISSPGV
AWQNPASAPAAPFYGSTAASTPVGQPPAWNPNMQAPGFASASTAYPNPPLMANSTPYYPA
IGSSSGAPPVSFQASQQRPQYGMPPGAPPHAPPAGQPMYFQK*

Other information
Ka divergence:-0.555556KaKs divergence:-0.812452
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):945Length 2 (bp):1389Length divergence:0.19
MFE 1 (kcal):-278MFE 2 (kcal):-443.81MFE divergence0.23