Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G082484-GRMZM2G030169
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381643
Function (paralog2):actin-2

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MADSEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFSVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDSLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELETAKSSSSVEK
SYELPDGQVITIGAERFRCPEVLFQPSFIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIS
RAEYEESGPAIVHRKCF*

MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFSVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDSLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELETAKSSSSVEK
SYELPDGQVITIGAERFRCPEVLFQPSMIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIS
RAEYEESGPAIVHRKCF*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1134Length 2 (bp):1134Length divergence:0
MFE 1 (kcal):-386.8MFE 2 (kcal):-404.36MFE divergence0.022