Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G082529-GRMZM2G168855
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383198
Function (paralog2):ALG2-interacting protein X

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5904615251595
Log2 mRNA fold difference:-1.424782881614
Log2 TE fold difference:-0.15619110234146
Sequences
Protein sequence

MASAAGSSNVMLAIHEKKTTATDLYRPLRLYIASTYSEREAAAADDDLSVVRDLRAAVEQ
PSLPDPSSLEQRRDALLAYARALALVEPRFPISPDRAHVHSLTFTWHDAFKGNKKCALAS
IHLEKASVLFNLGAVYSQIAVAADRSTDVGIKTACGAFQSAAGAFAWLRESGVAAKAVAA
GTTTVDITPECAGMLEKLMLAQAQECFFEKVIGGGKPPALCSKVARQVGIFYEEAYAALS
APPLSQHFDKTWVSHVQLKAAQFYADACYRYSLDLHQKEEIAEEIARLKIGMSALADAKK
AAKGVAAQLMDSVNKLESNMKTNLERAMKENDRVYLMRVPAAGSLGALSAASLVKPTSLS
EVLDASKERLFSSLVPDGSMKALSKYTEMVDNIIRTQAEKLQQASEITRVRLKEMDLPDS
ILSLEGNITLPLDLKEDVEAVQISGGPAGLESELQQLRDLSRVNQELLVQTEELLQKEAN
EDAQFRTQFGSRWTRPQSSTLTKNIQDRLNLFASNLKKAADSDSLIERGVKENYPLMSIL
DKRPIESALPSISRPIMSLDGNEDAIVGALKQSLRQLESLGAHRAGLEDMLKEMKRKDDI
LPKLMAGVGSHDDLFKKEIAKYDPICADIADNIVAQEQLLLQIQAQNEQFAAVFNIEDYK
AARERCYKQIAAAVAKYREFKKNINEGLNFYVTLQEAIGKIKQQCSDFIMTRNIQCREMI
EDVQRKLAGFSFSSSSHSSMQRNASVPPDQSSPSPPPHAQAPYASPPGVDSRLGYSQPEP
RPAYSQPYPPSYGAPPQQPSYGAPHPGQYQPPAHQPPPGHDYGQPAYPGWRGPYYNAPQP
QQSAPYPQPPYNAPGAYPPHQSNYYRPQ*

MASAAGSSNVMLAINEKKTITTDLYRPLRLYIASTYSEREAAAADDDLSVVCDLRAAVEK
PSLPDPSSLEQRRDALLAYARALALVEPRFPISPDRAHVHSLTFTWHDAFKGNKKCALAS
IHLEKASVLFNLGAVYSQIALAADRSTDVGIRIACGAFQSAAGAFAWLRESGAAAKAVAA
GTTTVDITPECAGMLEKLMLAQAQECFFEKVIGGGKPPALCSKVARQVGILYEEAYTALS
ASPLSQHFDKTWVSHVQLKAAQFYADACYRYSLDLHEKEEIAEEIARLKIGMSALADAKK
TTKGVAAQLLDSVNKLESNMKTNLERAMKENDRVYLMRVPAAGSLGALPAASLVKPTSLA
EVLDASKERLFSSLVPDGSMKALSKYTEMVDNSIRTQAEKLQQASEITRVRLKEMDLPDS
ILSLEGNITLPMDLKEDVEAVQISGGPAGLESELQQLRDLSRVNQELLVQTEELLQKEAN
EDAQFRTQFGSRWTRPQSSTLTKNIQDRLNLFASNLKRAADSDSLIERGVKENYSLMSIL
DKRPIESALPSISRPIMSLDGNEDAIVGALKQSLRQLESLGAQRAGLEDMLKEMKRKDDI
LPKLMVGVGSHDDLFKKEIAKYDPICADIADNIVAQEQLLLQIQAQNEQFAAVFNLEDYK
AARERCYKQIAAAVVKYQEFKKNINEGLNFYVTLQEAIGKIKQQCSDFIMTRNIQCREMM
EDVQRKLPGFRFSSSSRSSMQRNAASVPPDESSPSPPPPHAQAPYASPPGVDSRHGYSQP
EARPAYSQPYPPSYGATPQQPTYGAQHPGQYQPPPGHDCGQPAYPGWRGPYPYYNAPQPQ
QSVPCPQAPYNATGAYPPHQSNYYRPQ*

Other information
Ka divergence:0.581051KaKs divergence:0.436826
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):2607Length 2 (bp):2604Length divergence:-0.001
MFE 1 (kcal):-940.59MFE 2 (kcal):-928.13MFE divergence-0.007