Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G082686-GRMZM2G400281
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):zinc finger protein 1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.27331858652266
Log2 mRNA fold difference:0.54172421343579
Log2 TE fold difference:-0.57805588738134
Sequences
Protein sequence

MDLERMDETSSVNDQSAERRPTVAGGGGGAMPWLDLTLAVTAPRDEFPATTDGDSSSAAS
DGEPPPKPVPVPSSPPPPPPSAPAPHKVFSCNFCMRKFFSSQALGGHQNAHKRERSAAKR
SSAPSPAYQYQYHHLHAAQRMVMAGLPLEAHAALVRAALRVSPASAVIQKGAASQELAAA
ARKAAGAGAPGATSTAPRFHDGNSAAATSWAPALLYEIEEPVSSTWPGSFRMRTQPEPPS
SEEQASASEQSKKIDLDLRL*

MEQTDEASSVNEQSAERHSTAWLDLTLAVSASLPAPDDGDSSSAGGSDDGDPANNKPASP
PPDPAPAPAPPKVFSCNFCMRKFFSSQALGGHQNAHKRERSAAKRSATTPSSASAYRYHH
LHHAQRMAIAGLPLEAHAALVRAALRVSPASAAIHKDASQELAAATTSTAPRFHDGDVSA
TAAAQWAPAQLCEEPVSSTWPGSFRTRTQAEPPSPEQSQKMDLDLRL*

Other information
Ka divergence:0.0455465KaKs divergence:-0.0935947
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):783Length 2 (bp):684Length divergence:-0.067
MFE 1 (kcal):-406.7MFE 2 (kcal):-340.3MFE divergence-0.089