Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083150-GRMZM2G128518
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100276250

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.4302231094353
Log2 mRNA fold difference:1.1782124334517
Log2 TE fold difference:-2.7586300737377
Sequences
Protein sequence

MEHCYLRQPISRAEAVPERRSRLWQMDALPLPPRAEVLCPQPRRAARIPFAVSVNKAIPR
SNCALPPYRPASACDILDDLILSKNDFSDGADSSSGQAGFLCGSPPVRANNPVVHDPQFG
KRALPSMSPLGSSSHVKLKVEAGSPSCGVSSSPKVRIEGFACGNSETHYAVTPLLV*

MEHCYVGQPISRAEAMPERRSRFWQMDAPPPPRAEVICPQPRRATRIPLTAVETLNKASP
KMNGAFPPYRSDSTCDILDLILSKNDSDGDSSSQVGFLCGSPPIRADNPVIHDPQFGKRL
PSFSPLGGSSYGKMPAVRVEVGSPSCGVSSSPKVRIEGFACGNSETHYAVTFV*

www.000webhost.com

Other information
Ka divergence:-0.33483KaKs divergence:0.0357604
GC content 1 (%):61GC content 2 (%):56GC content divergence:-0.043
Length 1 (bp):531Length 2 (bp):522Length divergence:-0.009
MFE 1 (kcal):-204.4MFE 2 (kcal):-183.7MFE divergence-0.053