Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083243-GRMZM2G099167
Species:maize
Duplication type:WGD
Function (paralog1):Tubulin alpha-6 chain (Alpha-6-tubulin)
Function (paralog2):Tubulin alpha-5 chain (Alpha-5-tubulin)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.083961129757706
Log2 mRNA fold difference:0.28116527398543
Log2 TE fold difference:-0.36741929057235
Sequences
Protein sequence

MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK
HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT
SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGAEGADDEGDEGDDY*

MREIISIHIGQAGIQVGNACWELYCLEHGIEHDGTMPSDSSVGVAHDAFNTFFSETGSGK
HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT
SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGAEGADDEGDEGDDY*

Other information
Ka divergence:0.873589KaKs divergence:-0.979147
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):1353Length 2 (bp):1353Length divergence:0
MFE 1 (kcal):-486.7MFE 2 (kcal):-497.6MFE divergence0.011