Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083418-GRMZM2G032190
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282684
Function (paralog2):hypothetical protein LOC100191191

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVGGGRRGGAAEEVKLNTGNVFAALESLKKKKKGDKGKAAGSSSRKKHGEGAAQRQEPPQ
KELFWAPAPLTTKSWADVEDDDDDDYFATTAPPRPVWGTAGEPAKEEEDVDDAVRAALQE
DIESDDGDLDDEVDDGPEDEPEHDAEDAPAEPAIRTAAAPAAPPKDTERQLSKKELKKKE
LAELDAVLAELGLSANSSSTAQDAEKKGTNQIGDAEKKEDAPAPPESKASKKKKKKDKSS
KEGKETQEALDGSEETASAGPDEDTSAVDVKERLKKMASMKKKKSSRETDTAAKIAAAEA
AARSARLAAAKKKEKSHYNQQPVR*

MVGGGRRGGAAAEEVKLNTGNVFAALESLKKKKKGDKGRAAGPSSRKKHGAGAAQQQQEP
PQKDVFWAPAPLTTKSWADVEDDDDDDYFATTAPPRPVWAAAAAAEPAKEEEDVEDAVRA
ALQECKKNYHIDTEPNCTERKRFSQQDVESDDEDLDDEDLDDGAEHEVEDAPAELAVKTV
EALAAPPKDTERQLSKKELKKRELAELDAVLAELGLSGNSTSAAQDAEKEGANQAGDAEK
KEDATVPSESKTSKKKKKKDKSSKEGRKETQEAAEGSEETASAGPDEEDTTAVDVKERLK
KMASMKKKRSSKETDTGAKIAAAEATARSARLAAAKKKEKSHYNQQPVR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):58GC content divergence:0.009
Length 1 (bp):975Length 2 (bp):1050Length divergence:0.037
MFE 1 (kcal):-354.7MFE 2 (kcal):-383.15MFE divergence0.039