Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083518-GRMZM2G092704
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192511
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.6580430970673
Log2 mRNA fold difference:-1.0188706511686
Log2 TE fold difference:0.39203194043246
Sequences
Protein sequence

MIPTRSAQASFRDRTNEFRAAVERARRHAVPSSSSAPAAPSSSSTGPLDGLIAATSARSE
FNNRASKIGLGIHQTSQKLSRLAKLAKRTSVFDDPTVEIQELTAVIKKDITALNSAVVDL
QALCNSQNESGSLSKDTSNHSTTVVDNLKNRLMSATKEFKEVLTMRTENLKVHENRRQMF
SSSAAKDASNPFIRQRPLVARDPSESSVPPAPWASDSASTPLFQRKKTNGDHGASSSQPF
AQQQQLAVQQDSYMQSRAEALQNVESTIHELSNIFTQLATMVSQQGELAIRIDENMEETV
ANVEGAQGQLLKYLNSISSNRWLMMKIFFVLMVFLMIFIFFVA*

RRAASSTGVPRRDDLGHVGSLGSSTTARPRSGSGSTRPPRKLARLAKLAKRTSVFDDPTL
EIQELTSVIKKDITALNTAVVDLQALCNSQNESGSLSKDTTNHSTTVVDNLKNRLMSATK
EFKEVLTMRTENLKVHENRRQIFSSSAAKDESNPFIRQRPLVARDPSESSVPPAPWASDS
ASTPLFQRYGYTHNTP*

Other information
Ka divergence:0.713052KaKs divergence:-0.0438723
GC content 1 (%):51GC content 2 (%):49GC content divergence:-0.02
Length 1 (bp):1032Length 2 (bp):591Length divergence:-0.272
MFE 1 (kcal):-336.06MFE 2 (kcal):-170.92MFE divergence-0.326