Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083538-GRMZM2G129304
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281771
Function (paralog2):hypothetical protein LOC100383590

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.50502311103376
Log2 mRNA fold difference:0.58348088473365
Log2 TE fold difference:-0.081071357570747
Sequences
Protein sequence

MACGSRSRTNEMVDEYEKLVLRMNPPRVTVDNDSDMTATLLKVDSANKYGTLLEVVQVLT
DLKLTIKRAYISSDGEWFMDVFHVVDQDGNKLYDCQVIDRIEQSLGAGSLSFRGPPERAV
AVEAEAEEAQTTIELVGRDRPGLLSEVFAVLADLRCNVVASEVWTHDGRVAALVHVTDAD
TLGAIEDPARLDTARRLLRHVLRGSSRDKKAARAAVSARVVEHAPRRLHQMMRADRSARR
DGEGEGEGDGERERGGAGMPVVAVEDCAERGYTLVNVRCRDRAKLLFDTVCTLTDMQYVV
FHGTVIAEGSEAYQEYYIRHLDDRAASSGEERERLRRGLEAAIQRRYTEGLRLELCCEDR
VGLLSDVTRVFREHGLSVTHAEVGTRGARAANVFYVVDASSGEPVQAQAVAAVRAEIGEQ
LLFVREHQDAAAAAANGTRSTVAGGRRSLGNMIRSRSEKFLYNLGLIRSCS*

MACGSRSRRTSETVDEYEKLVLRMNPPRVTVDNDSDMTATLVKVDSANKYGTLLEVVQVL
TDLKLTINRAYISSDGEWFMDVFHVVDQDGNKLYDGQVIDRIEQSLGAGSLSFRGPPERL
VAVEAEAEEAQTTIELVGRDRPGLLSEVFAVLADLRCNVVASEVWTHDGRVAALVHVTDA
DTLGAIDDPARLDTVKRLLRHVLRGSSRDKKAARAAVSSARVEHAPRRLHQMMQADRSAR
REGGGDGDGEEERERGEASGNGNGVPVVAVEDCAERGYTLVNVRCRDRPKLLFDTVCTLT
DMQYVVFHGTVIAEGSEAYQEYYIRHLDDSSGEDRDRLCRGLEAAIQRRCTEGLRLELCC
EDRVGLLSDVTRIFREHGLSVTHAEVETRGARAANVFYVVDASGEPVQAQAAVDAVRAEI
GEQVLLLVREQQQDAAGGPKSPAGAGGRRSLGNMIRSRSEKFLYNLGLIRSCS*

Other information
Ka divergence:-0.333535KaKs divergence:-0.427356
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):1416Length 2 (bp):1422Length divergence:0.002
MFE 1 (kcal):-756.2MFE 2 (kcal):-753.2MFE divergence-0.002