Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083551-GRMZM2G070693
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281371
Function (paralog2):hypothetical protein LOC100194123

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEGLSWRTVCCLSVLCAVLFLRPAEGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTP
WHYSEEGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVH
VGHFSYFEQHAKDEHFAPLFEQIGKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVH
KALFESAALIAASVIQVYLLRRLFERKLGTSRV*

MEWLSWRTVCCLSVLCTVLFLRPVEGIRFVIDREECFSHNVEYEGDTVHVSFVVIKADTP
WHYSEEGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVH
VGHFSYFEQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVH
KALFESAALIVASVIQVYLLRRLFERKLGTSRV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):642Length 2 (bp):642Length divergence:0
MFE 1 (kcal):-228.2MFE 2 (kcal):-215.1MFE divergence-0.03