Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083580-GRMZM5G811567
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383059
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.19578741982485
Log2 mRNA fold difference:-0.17541841810133
Log2 TE fold difference:-0.017464844662799
Sequences
Protein sequence

MENTKLSSALFAGTHFDRKRFAADFARFRKGPALPSAATPSAPSPEKKRKRKSGKAKAKK
NKKRAQDAAAAASSDFVEGFSVFKGLADNNAELRSEKVDMRKDDDSVAVRRRKEIEREFE
RAAVLRKRFDIHIAGQNAPAPLESFEELISRYGCDSYLVGNLSKLGFQEPTPIQRQAMPI
LLSGRECFACAPTGSGKTLAFLFPLLMKIKPGSKGGVKAVILCPTRELAAQTVRECKKLV
KGRKYYIKLMTKELSKSGNFKDMHCDILVSTPLRLDHAVKKRDLDLSSVEYLVLDESDKL
FELGFVEVVDSVVEACSNPSIIRSLFSATLPDSIETLARTIMHDAIRVIVGRKNSASSLI
KQKLIFAGTERGKLLTLRQNFQESLNPPVLIFVQSKERAKELYKELAFDDIRVDVIHADL
SEQQRQDAVDNLRAGKTWVLIATEVIARGMDFKGVASVINYDFPESAAAYIHRIGRSGRA
GRSGEAITFFTEEDKPFLRNIANVLVSSGCEVPSWIMALPKLKRKKHRVDRDPISYLPDE
V*

MENTKLSSALFAGTHFDRKRFAADFARFRKGPALPSAATPSAPSPEKKRKRKSGKAKAKK
NKKRAQDAAAAASSDFVEGFSVFKGLADNNAELRSEKVDMRKDDDSVAVRRRKEIEREFE
RAAVLRKRFDIHIAGQNAPAPLESFEELISRYGCDSYLVGNLSKLGFQEPTPIQRQAMPI
LLSGRECFACAPTGSGKTLAFLFPLLMKIKPGSKGGVKAVILCPTRELAAQTVRECKKLV
KGRKYYIKLMTKELSKSGNFKDMHCDILVSTPLRLDHAVKKRDLDLSSVEYLVLDESDKL
FELGFVEVVDSVVEACSNPSIIRSLFSATLPDSIETLARTIMHDAIRVIVGRKNSASSLI
KQKLIFAGTERGKLLTLRQNFQESLNPPVLIFVQSKERAKELYKELAFDDIELM*

Other information
Ka divergence:1KaKs divergence:-0.997409
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1626Length 2 (bp):1245Length divergence:-0.133
MFE 1 (kcal):-543.1MFE 2 (kcal):-391.69MFE divergence-0.162