Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083725-GRMZM2G071575
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191531
Function (paralog2):lipid transfer protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATRRQWWWWCLLLLAAWCCAAAAQSPPAADPLQSKCQGDFGKLTDCMDYATGHAASPSS
TCCGDAGDTEKARPECLCYIIQQTHTGRNQVQSLGLRFDRLMALPAACNLPNSNVSLCIT
LLNLKPGSADYALFANASKSECSQLSQVNPSYHRQFATHPVTHWPLHCTQLTGNRRHRSV
FSCSHAVSRRQPCERQRRGQRRQAPGWGQRRRRARRGLRDRLVTLLMDRPPLKGAAAVFF
YPPVDSFSCCVPLAHVYSVLSHKKK*

MACTRRQLWWACLLAAWCCAGAAAAAQPPAADADPLQSRCQGDFGKLTDCMDYATGHAAS
PSSTCCGDAGGTQKARPECLCYIIQQVHAGRDQVQSLGLRFDRLLALPAACSLPNANVSL
CINLLNLKPGSPDYALFANASKITPSAGGSPASDTAAGSAVIRLQAGVRGSVALAVVSAI
VSSVF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):71GC content divergence:0.044
Length 1 (bp):798Length 2 (bp):558Length divergence:-0.177
MFE 1 (kcal):-357.5MFE 2 (kcal):-295.9MFE divergence-0.094