Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083788-GRMZM2G101125
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100274249

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.7325660867629
Log2 mRNA fold difference:1.6925462878728
Log2 TE fold difference:-0.92217005038178
Sequences
Protein sequence

MAPEKPRKEQEEEEDELMLEDGGIEESPRRSFEDCGDSDEEDDDNDEERDGDGVGSPRSF
QSHKWPQSYRETTDTYTIAASPSFGYLGPSTSKYSLLDLGRSGLGSDLKLPLLSDKADGK
QDSVKTLPKTLGSIRDERVSFQLQHTGELYITQGCNVTQTVFNGINVLAGVGLLSTPFTI
HEAGWTGLAVLVCFAIVCCYTGILLKHCFESKDGISSYPDIGEAAFGRIGRLLISIILYT
ELYTYCVEFIILEGDNLTTIFPKAGIDWFGIHVDGKHFFGVLTAILVLPTVWLRDLRVLS
YLSAGGVIATLLVFLSVGLVGATDGIGFHSTGKVVNWSGMPFAIGIYGFCYSGHSVFPNI
YQSMSDRSKFPKALFICFAICTAMYGSFAVIGFLMFGENTLSQITLNLPKHSIASKVALW
TTVINPFTKYALLLNPLARSLEELRPEGFLNETSCSIILRTALVASTVCIAFLLPFFGLV
MALIGSLLSILVAVIMPALCFLKIAQNKATCPQVIASVGIVILGVVSAALGTYSSVKKIA
ENY*

MAPEKPRKEQEEELMLEDGGIEESPRRSFEDCGDSEEDRGEGDDEEERDSDRDGVGSTRS
FLPQKWPQSYRETTDTYTIAASPSFGYLGSSTSKYSLLDLGRSILGSDLKSPLISAKADS
VRNLPKTLGSMRDGRVSFQLQHTGEIYISQGCNVTQTVFNGINVLAGVGLLSTPFTIHEA
GWTGLAVLACFAIVCCYTGILLKHCFESKDGISSYPDIGEAAFGRIGRVLISIILYTELY
SYCVEFIILEGDNLTSIFPKAGFDWLGIHVDGKHFFGVLTAILVLPTVWLRDLRVLSYLS
AGGVIATLLVFLSVGLVGVTDGIGFHSTGKAVNWSGMPFAIGIYGFCYSGHSVFPNIYQS
MSDRSKFPKALFICFAICTAIYGSFAVIGFLMFGKNTLSQITLNLPKHSFASEVALWTTV
INPFTKFALLLNPLARSLEELRPEGFMNETSCAIILRTALLASTVCIAFLLPFFGLVMSL
IGSLLSILVAVIMPPLCFLKIAQNKATCAQVIASICIVMLGVISAALGTYSSVKKIVENY
*

Other information
Ka divergence:0.425696KaKs divergence:0.515654
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1632Length 2 (bp):1623Length divergence:-0.003
MFE 1 (kcal):-531.48MFE 2 (kcal):-536.75MFE divergence0.005