Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G083894-GRMZM2G134334
Species:maize
Duplication type:WGD
Function (paralog1):LOC100127541
Function (paralog2):AN18

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.36685921022784
Log2 mRNA fold difference:0.063821673405745
Log2 TE fold difference:-0.38049085084798
Sequences
Protein sequence

MAQRDKKEEPTELRAPEIALCANNCGFPGNPATQNLCQSCFSASRSSSSSSQPSPTSSPS
ASAPAAAVPQPRPALLDAALQLAPPAAAAGQPVEASARTSANRCSSCRKRVGLTGFRCRC
GDLFCGAHRYSDRHGCRYDYRGAARDAIARENPVVRAAKIVRF*

MAQRDKKEEPTELRAPEITLCANNCGFPGNPATQNLCQSCFSASRSPSSPTSSSSSLASA
ASQPRPAALVVDAAAVEALAAPAAAAVGQATEAAARASASRCSSCRKRVGLTGFRCRCGE
LFCGAHRYSDRHGCSYDYRGAARDAIARENPVVRAAKVVRF*

www.000webhost.com

Other information
Ka divergence:0.205542KaKs divergence:0.108504
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):492Length 2 (bp):486Length divergence:-0.006
MFE 1 (kcal):-259.3MFE 2 (kcal):-256.66MFE divergence-0.005