Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G084149-GRMZM2G075655
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273319
Function (paralog2):hypothetical protein LOC100277246

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGISRPLVMAMAVALLIAVAGATAEEQEPLLAADAVAGAVEAALGEVETAALRAELGQLR
AKISALESDIEERSQELKNKDDAIMNLEKAIEEKSKAITSMLDEIASLQAKGSVAAEEQA
NKANAKVVELEKQVDKIKKDIEAQSSQKAALEYRANDAEKKVEVLNEKLNTIQKESDEKK
RKIKKTERALKVAEEELMRLQLEVTAKSKQLSEVHGAWLPPWLMAQYACYAEVVSGHWDQ
HGKPAVQNFLHKASEKSAQAKKWAEPHIETAKMKWIPVKQKLVALKKNAEPYVQKVSTRS
VEFYESSRDAVTPHAVKVKVFVHSYYQKAKKFSKPYIDQIAEITKPHVEKIRTTLKPYTK
RAVHAYGSFLKSATTYHRQAQASIMDYLHQHDITKSLATKELVWFLASALLALPVFIIYR
LLVGTFCSKKNKRPRSSNGNHGHKRYKRRHADK*

MGISRPLALLLALLIAVAGATAEEPVVAADSVAGAVEAAAALRVEEAAEAAALRAELEQL
RAKISALESDIAVRSLELKNKDDVIVNLEKAIAEKSKAITSMQGEIASLQAKGSLAAEEQ
ANKANAKAVELEKQIDKLKKDIQAQSSQKAALESRANDAENKVEKLNEKLNTMQKESDEQ
KRKIKKTERALKVAEEELMRLQLEATAKSKQLTEVHGAWLPPWLATHYARYMEVVSGHWN
YHGKPAVQNVLHKASEKSAHAKKWAEPHIETAKMKWIPVKEKLVVLKKNAEPYVQKVSTR
SVEFYESSRDAVTPHVVKVKEFAHPYYQEAKKFSKPYIDQIAEITKPHVEKVRTTLKPYT
KRAVHAYGSFLGSATTYHRQAQATIMDYLHQHGVPKSFATKELVWFLASALLALPVFVIY
RLVVETFCTKKNRRPRGGNGNGNHGQKRHKRRYADK*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1362Length 2 (bp):1371Length divergence:0.003
MFE 1 (kcal):-440.71MFE 2 (kcal):-472.08MFE divergence0.034