Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G084327-GRMZM2G138870
Species:maize
Duplication type:WGD
Function (paralog1):fiber protein Fb34 (LOC100284397), mRNA
Function (paralog2):fiber protein Fb34

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.46695178502181
Log2 mRNA fold difference:-0.88109203763349
Log2 TE fold difference:0.44971667345318
Sequences
Protein sequence

MVATRCFCCGRALSPGRWRAWSGICFIVCWVTFVIAELCLLAGSVRNAYHTKYFPKGDGP
PPCAMLRKGVFAAGAAFTFLAALFAELHYLFYARARDAAAAVAPPIVGGIGMTRM*

MASIIVIAVVLVLDVLAFVLAIGAERRRSYANVTAADSSGRAYCVYSSDASTAYGVSALL
LLLAAQAVAMAATRCFCCGRGLSPGRWRAWSGTCFIICWVTFVIAELCLLAGSVRNAYHT
KYVSLFSNAPPRCAVLRRGVFAAGAAFAFLTALLAELHYLFYARARAAAAVPPPIVGGIG
MTRM*

Other information
Ka divergence:0.352849KaKs divergence:-0.999579
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):348Length 2 (bp):555Length divergence:0.229
MFE 1 (kcal):-162.9MFE 2 (kcal):-272MFE divergence0.251