Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G084540-GRMZM2G126120
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.60148240018361
Log2 mRNA fold difference:-0.52961006281351
Log2 TE fold difference:-0.071341376915134
Sequences
Protein sequence

MAGHRNSHGKRQSDFTENGGSKRRNPGDDTYAPGPDDTVYRYLCASRKIGSIIGRGGEIA
KQLRTETQAKIRIGESVPGCDERVVTIFSTSRKTNTIDGAEDEVCPAQDALFRVHERLAS
DEGLGNEDSEEISPQVTVRLLVPSDQIGCIIGKGGQIIQGIRSETGAQIRVLSNDHIPAC
AISGDELLQISGDTVVVRKALHQVSSRLHNNPSKSQHLLASSLTQPYPGSTHLGGSSTAP
VVGITPVIPPYGGYKGDVAGDWPSLYQPRRDESSAKEFSLRLLCAAANVGGVIGKGGGII
KQIRQESGALIKVASSNSDPDDDCIITVSAKEFFEDPVSPTIDAAVRLQPRCSEKSDLES
AEQSYTTRLLVSTSRIGCLIGKGGSIITEIRRTSRANVRILSKENVPKVAAEDDEMVQIT
GGLDVARNALVQIATRLKANFFEREGSLSAFPPVIPYHPLPAGVSDEPKYLGRDTKPVGH
YLYSSGFRTSDDTIPSDSYASYGGSQAPGRGYGAYSGYSARSSNSGLSGHSSLHYGKRHG
Y*

MSGHRNSHGKRYSDYTETGGGKRRNPGDDTYAPGPDDTVYRYLCASRKIGSIIGRGGEIA
KQLRTETQAKIRIGESVPGCEERVITIFSSSRRTNTIDDAEDKVCPAQDALFRVHERLAT
DESFGNEDSEEISPQVTVRLLVPSDQIGCILGKGGHIIQGIRSETGAQIRVLSKDHIPAC
AISGDELLQISGDMVVVKKALCQVSSRLHNNPSKSQHLLASSLTQPYPGGTHLGGSSAAP
VVGITPVIPPYGGYKGDVAGDWPSLYQPRRDESSAKEFSLRLLCAAANVGGVIGKGGGII
KQIRQESGALIKVASSNSDPDDDCIITVSAKEFFEDPVSPTIDAAVRLQLRCSEKSDSEL
AEQSYTTRLLVSTSRIGCLIGKGGSIITEIRRTSRANIRILSKENVPKVAAEDEEMVQIS
GGLDVARHALVQIATRLKANFFEREGSLSAFPSVIPYHPLPAGVSVSDEPKYLSRDTKPV
GHYLYSSAFRTSDDMIPSDSYASYGGSQAPGGGYAAYSGYSARSSSSGLSGHSSLHYGKH
HGY*

Other information
Ka divergence:0.0789921KaKs divergence:-0.390356
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1626Length 2 (bp):1632Length divergence:0.002
MFE 1 (kcal):-528.63MFE 2 (kcal):-535.54MFE divergence0.006