Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G084583-GRMZM2G419239
Species:maize
Duplication type:WGD
Function (paralog1):Myb-related protein Zm38
Function (paralog2):transcription factor MYB42

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.30666906263228
Log2 mRNA fold difference:0.87708627525218
Log2 TE fold difference:-1.2134758938702
Sequences
Protein sequence

MGRSPCCEKAHTNRGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY
LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHVRRKLLGRG
IDPVTHRPIAADAVTVTTVSFQPSPSAAAAAAAEAEATAAKAPRCPDLNLDLCISPPCQQ
QEEEEEVDLKPSAAVVKREVLLGGRGHGHGGALCFGCSLGVQKGAPGCSCSSSNGHRCLG
LRGGMLDFRGLKMK*

MGRSPCCEKAHTNRGAWTKEEDERLVAYVRAHGEGCWRSLPRAAGLLRCGKSCRLRWINY
LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGSG
IDPVTHRRVAGGAATTISFQPSPNTAVAAAAETAAQAPIKAEETAAVKAPRCPDLNLDLC
ISPPCQHEDDGEEEEEELDLIKPAVVKREALQAGHGHGHGLCLGCGLGGQKGAAGCSCSN
GHHFLGLRTSVLDFRGLEMK*

Other information
Ka divergence:0.176794KaKs divergence:0.510269
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):765Length 2 (bp):783Length divergence:0.012
MFE 1 (kcal):-388.3MFE 2 (kcal):-394.7MFE divergence0.008