Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G084717-GRMZM2G460566
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100303905
Function (paralog2):hypothetical protein LOC100278404

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPSSAMSSGLEPVLCAPRPRRVQQLHPCSADLILGAPPFPRNANSKVRTRSLVAPPPQAL
VVRRRLQSRALPRSRYRPAAAAAGKEAGRRPGRRRRTRTAAGRRSAGRRRRARTTRWCTT
PGSCGTSATRRRWSSGRRTTGGRPTAAVATAAGLPRRRSRRP*

MPSRSMSRLSVESASGSGGGGCREAEPVLCAPRPRRAQQQLVHVHPRGADLILGPPPFLL
NESSEEGRCSWAAFGGGSPPARAGNPLVHDPSFLLSQRHPAADPPLELGFFDHLIRTSSY
VHRPTPTTSYTSTSSSGSSSKSSFGPSSFAPAVRIQGFDVAACRSSHSGGGGAGGRVLSA
ARA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):74GC content divergence:0.021
Length 1 (bp):489Length 2 (bp):552Length divergence:0.061
MFE 1 (kcal):-239MFE 2 (kcal):-295MFE divergence0.105