Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G084757-GRMZM2G180724
Species:maize
Duplication type:TD
Function (paralog1):60S ribosomal protein L15
Function (paralog2):60S ribosomal protein L15

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.51405622001119
Log2 mRNA fold difference:-0.1658198569686
Log2 TE fold difference:-0.35093905586899
Sequences
Protein sequence

MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV
VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW
VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT
HHKNRPSRRATWKRNQTLSLRRYR*

MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV
VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW
VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT
HHKNRPSRRATWKRNQTLSLRRYR*

Other information
Ka divergence:1KaKs divergence:0.996992
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):615Length 2 (bp):615Length divergence:0
MFE 1 (kcal):-243.2MFE 2 (kcal):-239.2MFE divergence-0.008