Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085005-GRMZM2G139198
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274503
Function (paralog2):partner of Nob1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.59360583831448
Log2 mRNA fold difference:-1.1843229648286
Log2 TE fold difference:0.5538961795458
Sequences
Protein sequence

MASATGGSSSEMAVDHATGLGTVEKPRFDALMPSEMSGGRTQFRKVTVPQHRFAPLKRCW
MEIYTPVYEHMKIDIRMNLKARRVELKTRQDTPDVSNLQKCADFVHAFMLGFDIADAVAL
LRLDDLYVDSFEIKDVKTLRGEHLSRAIGRLSGKGGKTKYAIENSTRTRIVIADTKIHIL
GSFVNIKVARDSLCSLILGSPAGKVYSKLRAVSARLAERY*

MPVSCPDVPLLDSPLLKTHSMASATGVSSSEMAVDHATGPGAVDKPRFDALTPNEMSGGR
PQFRKVPVPQHRFAPLKRCWMEIYTPVYEHMKIDIRMNLKARRVELKTRQDTPDVSNLQK
CADFVHAFMLGFDIADAVALLRLDDLYVDSFEIKDVKTLRGEHLSRAIGRLSGKGGKTKY
AIENSTRTRIVIADTKIHILGSFVNIKVARDSLCSLILGSPAGKVYSKLRAVSARLAERY
*

Other information
Ka divergence:0.0528899KaKs divergence:0.155556
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):663Length 2 (bp):723Length divergence:0.043
MFE 1 (kcal):-241.7MFE 2 (kcal):-267.3MFE divergence0.05