Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085049-GRMZM2G012814
Species:maize
Duplication type:WGD
Function (paralog1):rho GDP-dissociation inhibitor 1
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSSAVEAISCPKVDVPAGPEPGEPAKEAAPPAEHCDTAPNGKCAPRCHGEEEEEEEDEED
EEKAPKAIDLGPMVSIKEQLEKDKDDESLRRWKEQLLGGVDLNSVGETLEPDVKIMSLSI
LSPGRPDIVLPLPVEPNGKGVWFTLKEGSPYRLKFTFSVSNNIVSGLRYTNTVWKTGLKV
DRAKEMLGTFSPQLEPYTYVTPEDTTPSGMFARGSYSARTKVRTYVDAEPVLFRFTQNPS
GSIVHEVWFGILFFDSSSTTTASATWRSTTPSTSAGSGRRRADHPSLPPSVA*

MSSAVEPVSCSKVDVPAAGPDPEDAAAPAGHGEAAPCCHEEEEEEEEEKAPQAIDLGPMV
SIKEQLEKDKDDESLRRWKEQLLGGVDLNSVGETLEPDVRITSLSILSPGRRDIVLPLPV
DATKGVWFTLKEGSPYRLKFTFSVSSNIVSGLRYTNTVWKTGLKVDRAKEMLGTFSPQPE
PYTYVTPEDTTPSGMFARGSYSARTKFLDDDRKCYLEINYAFDIRREWPSAS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):63GC content 2 (%):66GC content divergence:0.023
Length 1 (bp):879Length 2 (bp):699Length divergence:-0.114
MFE 1 (kcal):-387.6MFE 2 (kcal):-305.8MFE divergence-0.118