Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085392-GRMZM2G139193
Species:maize
Duplication type:WGD
Function (paralog1):early nodulin-like protein 3
Function (paralog2):early nodulin-like protein 3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.10084156248924
Log2 mRNA fold difference:0.40309711564581
Log2 TE fold difference:0
Sequences
Protein sequence

MAHGRMMMGCVFLACLLVAASVPSTASAFVFKAGGTGEWRVPAAAAGSNVSAYNAWAQRN
RFRVGDAIAFTYQPGKDSVLLVDERSYDACDASSPTDTFADGSTVFTFNRSGPFYFISGN
KGNCDRGEKLVVVVMAERAAIGTGGTGLAPSPSSSSSPNGPFSAFSPPPPPFGIDISPSP
TAAYPPPSAAPPKMAGLAGAAAFAIIGALFYALV*

MAQGRMSCVFLACLVAVASVSASTASAFVFKAGGTGEWRVPAAAGSGNGSSYNAWAQRNR
FRVGDAIAFTYQPGNDSVLLVDKRSYDACDTGSPTDTFADGSTVFTFTRSGPFYFISGNK
DNCDRGEKLIVVVMAERAAVGNATEPGAGLAPSPSGPFSSFSPPPPFGIDISPTAPYPPP
NAAAPPKVAAGVAGAATFAIGALFYALV*

Other information
Ka divergence:-0.283377KaKs divergence:-0.0116714
GC content 1 (%):68GC content 2 (%):70GC content divergence:0.014
Length 1 (bp):645Length 2 (bp):627Length divergence:-0.014
MFE 1 (kcal):-298.5MFE 2 (kcal):-302.96MFE divergence0.007