Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085467-GRMZM2G417597
Species:maize
Duplication type:WGD
Function (paralog1):helix-loop-helix DNA-binding domain containing protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.65291988482163
Log2 mRNA fold difference:-2.046686751672
Log2 TE fold difference:1.4086306412002
Sequences
Protein sequence

MYGAPLPKDLNLPAALPQPTRTPPQQQMGSPGLLRYRSAPSTLLGEVMCGGDQDFPAAGG
AGHGPPDHAAADNVLARFLAGHHSETRDCKPPRPAAAAHFMDEAAVASMAASQQQQLMYQ
SQQEQQMAAMEGLYRNVSSGGTEHGAAVGAGNNSLIRQSSSPAGFLNHLNMDNGYGSMLR
VGMGGGGFRNGVSDARLKGQLSFSSRQGSVMSQISEVGSEELDGGGGSGSPEAAGSNASG
AARGYSGIPGYPMGGLASGAWPDEASPSPTSGAKRPRDSGPALQQPLAPQLSLPSGKNKG
GRAASAEMAAIEKFLQFQDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPN
MEKQTNTADMLDLAVDYIKDLQKQVKVLNDGRASCTCSAGELQGQFTR*

MRRRGFAGYGGMLRAGMGMAGGFRNGVSDARLKGQLSFPSRQGSVMSQISEVGSEELDGG
GGGSPEAAGSNASGAPRGYVGIPGYPMGGGTSGAWSDEPSPSPTSGAKRRPRDSGPAPQN
VQQQPLAPQLSLPSGGKPASAEMAAIEKFLQFQDAVPCKIRAKRGCATHPRSIAERVRRT
KISERIRKLQELVPNMEKQTNTADMLDLAVDYIKDLQKQVKVLNDGRANCTCSGGGKLQD
PFTS*

Other information
Ka divergence:0.18914KaKs divergence:-0.673219
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1227Length 2 (bp):735Length divergence:-0.251
MFE 1 (kcal):-632.8MFE 2 (kcal):-389.9MFE divergence-0.238