Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085582-GRMZM2G122569
Species:maize
Duplication type:WGD
Function (paralog1):nucleic acid binding protein
Function (paralog2):hypothetical protein LOC100382071

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.69634159357608
Log2 mRNA fold difference:-0.339731869576
Log2 TE fold difference:-0.4303595581873
Sequences
Protein sequence

MDGLHGTDACFSPARAISPQVRPPGPPDVGSQYLAELLQEHQKLGPFMQVLPICSRLLNQ
EIVRVSNIRRQHGVAGDFERFPAASPNQMHPAPPMTNFCGNGFSPWNGMHSERVGVPQGA
MGWQGPPQSPSSYIVKKILRLEVPTEAYPNFNFIGRLLGPRGNSLKRIEASTGCRVFIRG
KGSIKDSGKEEQLKGRPGYEHLSEPLHILIEAELPANVIDARLAKAQEILEELLKPVDES
QDYYKRQQLRELAMLNSPLREESPHPGGAPPSPFSNGGMKRVKQ*

MDGLHGTDACFSPARAVSPQVRLPGPPDVGSQYLAELLQEHQKLGPFMQVLPICSRLLNQ
EIMRVLNIRRQHGAAVDFEKFAAASPNQIHPSPPMPNFCGNGFSPWNGMHSERVGVPQGA
MGWQGPPQSPASYIVKKILRLEVPTETYPNFNFIGRLLGPRGNSLKRIEACTGCRVFIRG
KGSIKDSGKEEQLKGRPGYEHLSEPLHILIEAELPANVIDARLAKAQEILEELLKPVDES
QDYYKRQQLRELAMLNSPLREESPRSGGAPPSPFSKTVSGRPNKTGDTEL*

Other information
Ka divergence:0.567835KaKs divergence:0.420545
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):855Length 2 (bp):873Length divergence:0.01
MFE 1 (kcal):-299.75MFE 2 (kcal):-313.65MFE divergence0.023