Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085630-GRMZM5G868354
Species:maize
Duplication type:WGD
Function (paralog1):holocarboxylase synthetase
Function (paralog2):holocarboxylase synthetase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4454510169368
Log2 mRNA fold difference:2.3834693205612
Log2 TE fold difference:-0.93896857272698
Sequences
Protein sequence

MTGKKRKAEAARLEETDQALYGAFRGAANSLSQLYTLAMGAQKASFNAGERHAMEKLYEW
ILRQHENGLRLTVADVASRIQLEIQYGGDNASASPRPQYPSQSTAPTVHIPNTSNQQPSP
SLFAPGNPGLTQSKNSMVFSNALSSPIRRSLQPYHLEQDGDTGYFVNGASRDMNPTASND
SSMDMHSDSPVHDSY*

MAGKKRKAEAARLEETDRALYGAFRGAANSLSQLYTLGMGAQKASFHAGERHAMEKLYEW
ILRQHENGLRLTVADVASHIQHEIQYGGDNASASPRSQYPSQSTAPTMHIPNTSNQQPSP
SLFASGNPGLTQSKNSMVFSSALSSPIRRSLQPYHLEQDGDAGYFANGASRDVNPTASND
SSMDMHSDSPAHDSY*

Other information
Ka divergence:-0.422241KaKs divergence:-0.0388087
GC content 1 (%):55GC content 2 (%):57GC content divergence:0.018
Length 1 (bp):588Length 2 (bp):588Length divergence:0
MFE 1 (kcal):-195.8MFE 2 (kcal):-205.4MFE divergence0.024