Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085670-GRMZM2G171745
Species:maize
Duplication type:WGD
Function (paralog1):COP9 signalosome complex subunit 7
Function (paralog2):hypothetical protein LOC100191376

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.60643988267172
Log2 mRNA fold difference:-0.94690653550352
Log2 TE fold difference:0.34102211629909
Sequences
Protein sequence

MAMDAERRQAELIAQFSSQAVALSSAQQLAALVLEATSHPALFAFSELLALPALSMLAGT
QYSSSLDLLRLFAYGTLKDYKNNSGSLPALLPDQVRKLKQLSVLTLAESTKILPYDQLMQ
ELDVSNVRELEDFLINECMYSGIVRGKLDQLRRCFEVQFAAGRDLTPDQLNNMIEILSDW
LGTSDSLLHQIQEKIKWADTMSDVNKKHQKEFEDRVEEAKKSIKQADIDIRGHDDYLSES
VGIMDFEEDRVRPKRRRQPLA*

MAMDAERRQAELIAQFSAQAAALSSAPQLAALVLEATSHPALFAFSELLTLPALSKLTGT
QYASSLDLLRLFAYGTLNDYKSNSGFLPALLPDQVRKLKQLSVLTLAESTKILPYDQLMQ
ELDVSNVRELEDFLINECMYSGIVRGKLDQLRRCFEVQFAAGRDLTPDQLKNMIETLSDW
LGTSDRLLHQIQEKIKWADTMSEVNKKHQKEFEDRVEEAKKSIKQADIDLRGHDEFLSES
GGIMDFEEDRVRPKRRRQPPA*

Other information
Ka divergence:-0.413721KaKs divergence:-0.257143
GC content 1 (%):50GC content 2 (%):52GC content divergence:0.02
Length 1 (bp):786Length 2 (bp):786Length divergence:0
MFE 1 (kcal):-254.71MFE 2 (kcal):-268.01MFE divergence0.025