Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085675-GRMZM2G153863
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194267
Function (paralog2):hypothetical protein LOC100272779

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.034478301371432
Log2 mRNA fold difference:-0.68136662761289
Log2 TE fold difference:0.65045538460277
Sequences
Protein sequence

MASRRCLLRFLSIRLVPQRSQPLAPISTATRTLTSLSEALGSPAPRALASPRLYYPSRCH
FATRSSGDEDDGEDEEEHYDDEGSDGEWGDDEEVVAAKKPSGKTEEEKVAEAAEIGYKVL
GPLGADDKPFKPYEPVFAVVQIGSHQFKVSNGDSIFTERLKFCDVNDKLVLNRVLMLGSQ
AQTVIGRPILPDAAVHAVVEEHALDAKVIIFKKKRRKNYRRTKGHRQELTKLRITNIEGI
DKPEAAAVAT*

MASRRCLLRLLSSRLVPQRSQPFAPGSIATRTLTTSSEALGPPAPGALPSPRLYYLSRCH
FATRSSGDEDDEYEDEEEHYDEEDSEGEWGDDEEAVAAKKPSGKTEEEKVAEAAEIGYKV
LAPLGADEKPFKPYEPVFAIVQIGSHQFKVSNGDSIFTERLKFCDVNDKLFLNRVLMLGS
QTQTVIGRPILPDAAVHAVVEEHALDAKVIIFKKKRRKNYRRTKGHRQELTKLRIINIEG
IDKPETAAVAA*

Other information
Ka divergence:0.179321KaKs divergence:-0.0193771
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):753Length 2 (bp):756Length divergence:0.002
MFE 1 (kcal):-274.43MFE 2 (kcal):-277.46MFE divergence0.005