Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085945-GRMZM2G121151
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279115
Function (paralog2):hypothetical protein LOC100275474

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.3571322764148
Log2 mRNA fold difference:1.6831324889254
Log2 TE fold difference:-0.32495183189514
Sequences
Protein sequence

MAKPQEVRSVDSFSQLPFIRPAPAPRDATIRLFGREFPSDHNQQQQDAASDSPDAANNGS
TVTCESNGAAKSGAAAERKFECHYCCRNFPTSQALGGHQNAHKRERQHAKRAHLQASLAM
HRYVPGHMYGLFNYYPHPHPIGGGARFDHPAPPPPPLQHYPMWTTSASPAGPYGGGPGSM
SQPINGSPVPAGLWRVPPPPAATAMENFGVSARHGASGGTAFPVGPPGGEAAACKDDKAA
VMMSLLSPSPSLSSCSSTSPETKLAGRYELARQKETVVSLDLHL*

MAKPQEVRSVDSFSQLPFIRPAPPPAPAQPRDATIRLFGCDFSNDDQQQRQAKQQQQHRQ
DAGAAADSPDAANGSSITSESNNGANKSGGADRKFECHYCCRNFPTSQALGGHQNAHKRE
RQHAKRAHLQASLAMHRYVPGHMYGLFNYHQQQQHHLGGGGGGRFDYPAPLQLPPPPPAR
YPMWTSAGPAGPYGGGPGSMSQPINGSPVPPGLWRVPPPAATTTTTTAMENFGVPGRRHG
AGGGTAAVLAAGPAGAEAAACKDDAMGLLSPSPSLSSCSSTSPEKKKLGRCELGRQKETV
SLDLHL*

Other information
Ka divergence:-0.165232KaKs divergence:-0.224502
GC content 1 (%):69GC content 2 (%):71GC content divergence:0.014
Length 1 (bp):855Length 2 (bp):921Length divergence:0.037
MFE 1 (kcal):-413.88MFE 2 (kcal):-464.7MFE divergence0.058