Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G085948-GRMZM2G058105
Species:maize
Duplication type:WGD
Function (paralog1):protein binding protein (LOC100284381), mRNA
Function (paralog2):LOC100282919

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDGSKGSVGGGDGTGPEKPSADSNPSLDPPQPTAAAVEATDDGAAAAAAEAARRPFTALS
QEEADLALARVLQEQERAYMLLRMNGGGGEGSDYGSSDEGSYEYDEEGEEDYEEELEHRL
RVHHHEHPSGDGEGEGGGEGEGAEGSDYDEEFEEDEEGEPEVDPAEFEDDEAYARALQDA
EEREVAARLMALAGLSDWRTVEVEHEEDHANDPQEAWQEVDPDEYSYEELVALGEVVGTE
NRGLSADTLGSLPSVTYKLQHVQDGNTEQCVICRVELEEGESLIALPCKHLYHPECINQW
LQINKYIFQHFCWRIMPCQPLP*

MEGSKGSGGGGAGAGSEKPSAESNPSLNLPPPTAADVEATDDGGATAAAAAAAEAARRPF
TALSQEEADLALARVLQEQERAYMLLRMNGSGGEGSDYGSSDAGSYEYDEEGDDYEEELE
HHLRVHHHEHPSGDGDGEGEGEGAEGSDYDEEYEEDEEGEPEVDPAEFENDEAYARALQD
AEELEVAARLMALAGLSDWRTVDVEHEEDHVNDPQEAWQEVDPDEYSYEELVALGEVVGT
ENRGLSADALASLPSVTYKMQSVQDGNTEQCVICRVELEEGESLIALPCKHLYHPECINQ
WLQINKVCPMCSAEVSTSSNKEP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):58GC content divergence:-0.009
Length 1 (bp):969Length 2 (bp):972Length divergence:0.002
MFE 1 (kcal):-390.2MFE 2 (kcal):-403.4MFE divergence0.017