Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086032-GRMZM2G124254
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275702
Function (paralog2):hypothetical protein LOC100192621

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.510906157721
Log2 mRNA fold difference:0.032580035403752
Log2 TE fold difference:0.49330804250066
Sequences
Protein sequence

MDSLLATYASSDDDADSDEAPSTAPAASSGGRAGGLFSLPQPKSAPALLFSSLPAPKSTP
EPLFSSLSAPKSANAPTFSSIPAPKTSGGNPKRVVQYRPQPILQSAGDSSDDDEDDAKKR
RASNNEASLPHVSAGLGPVSSFLPPPKHSLGLGSGSGAGARRSAIDTAAPEKPNLSNAVP
SSSVTNTGAPERPSTGASDDDDSEDSGSEGDMPAPELEEEHQEQPSFNAAAAEQQQGHDA
GAGSTSGYGTYAWDPNYYAQYGANYGWDPSASASYEDGTQYAAYEEGQSGGYAHSHGGEH
GSGYEHVAAVPYGVDYTGGYGHEVAATALPPVQEPVLPPEMGRIGGKRGRNDMPAQILEV
NQAELMKNRPKQDKSKLTGLAFGPSYQPAPSAKGKPSKLHKRKHQIGSLYFDMKSKEMEL
AERRSKGILTKAETQAKYGW*

MDSLLASYASSDDDADEAPPAPPPAHSPAIATSSGGGAGGFFSSLPQPKSAPAPLFSSLP
APKSTPTPLFSSLSAPKSSPAPNPTFSSIPPPKSSGGNPKRVVQYRPQPIRQPTGDSSDD
EEDDPKKRRASNNEARLPPVSAGSGPVSSFLPPPKHSLGLGAGSGAGARRSAIDTAAPEK
LNLGTALPSSSVANTGAPERPDTGATDDDDSEDSGSDGDMPAPELEEEHENQQAFNAATG
EQQQSYDAGAGSTSGYETYAWDPNHYAQHGAYGWDPSASANYEDGTQYAAYERGQSAGYV
HAHGGEHASGYDHVAAVPYGVDYTAGGYGHEVAATLPPVHEPILPPEMGRSGGKRGRNDT
PVQILEVNQAELMKNRPKQDKSKLTGLAFGPSYQPAPSAKGKPSKLHKRKHQIGSLYFDM
KSKEMELAERRSKGILTKAETQAKYGW*

Other information
Ka divergence:-0.108437KaKs divergence:-0.422063
GC content 1 (%):59GC content 2 (%):58GC content divergence:-0.009
Length 1 (bp):1323Length 2 (bp):1344Length divergence:0.008
MFE 1 (kcal):-530.5MFE 2 (kcal):-530.3MFE divergence0