Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086138-GRMZM2G081221
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279282
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MYRGGLDRFKKAQTLEPFSVKSESGTKKAPAAAGTAKAPPAPLTLPQNSNFVLGQNNQSL
QGTNTRVAGQDGVAPGHVGTQAGGGQSTWQPPDWAIEPRPGIYYLDVVKDGEVIDRINLD
NRRHLFGRQVPACDFVLDHQSVSRQHAAVVPHRNGSIYVIDLGSVHGTFVANERLTKDNP
VELEVGQSLRFAASTRIYILRKNTAALFPTPSLPSDVSLPSPPDPNDEDAVVAYNTVLNR
YGISKSDILSSSKDSSGSASSGANDDKHAVERPLKRSKKRRVSFRDQAGGELTQVVGISD
GADVETEPGPIGVKEGSLVGKYESLVQVTVIPKGKEQASRKDFTSTSPSGVTDKLQEVLK
RVKSTTRPGIYDDLYGDSIATKVGSSWAYKSDDLSDKAQPVEEKTLGMDSNLNSADDSDD
LFGDT*

MYRGGLDRFKKAQTLEPFSVKSESGTKKAPAAAGTAKALAPLTLPLDSNFVPGQNHQSPQ
GTISRVAGQDGDAPGHVGTQVGGGQSTWQPPDWAIEPRPGVYYLDVVKDGEVIDRINLDN
RRHLFGRQVPACDFVLDHQSVSRQHAAVIPHRNGSIYVIDLGSVHGTFVANERLTKDNPV
ELEVGQSLRFAASTRTYILRKNAAALFPTPSLPSDVSLPSPPDPNDEDAVVAYNTVLNRY
GISKSDILSSSKDSSGGASSANDGKHAVERLLKRGKKRRVSFRDQVGGELIQVVGISDGA
DVETEPGPIGVKEGSLVGKYESLVQVTVIPKGKEQASRKECTSTSPSGVTDKLQEVLKKV
KSATRPGIYDDLYGDSVPAKVGSSWAYKSDDQPVEEKTRGMNLNMNSADDSDDLFGD*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1278Length 2 (bp):1254Length divergence:-0.009
MFE 1 (kcal):-415.4MFE 2 (kcal):-414.48MFE divergence-0.001