Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086489-GRMZM2G104294
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279923
Function (paralog2):hypothetical protein LOC100304425

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0390253195711
Log2 mRNA fold difference:-0.89083091475105
Log2 TE fold difference:-0.14449462242845
Sequences
Protein sequence

MAALEAAREWAGSVIPPELAAAAGGDPLAALAATAAALVAGLLIIAVWFRSGGGTPSKPV
ATPVRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMAEEARARYEKAVFKVVDL
DDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDLKYGI
FGLGNRQYEHFNKVAKVVDELVEEQGGKRLVPVGLGDDDQCIEDDFTAWKELVWPELDQL
LRDEDDTTGASTPYTAAIPEYRVVFIDKSDLSFQDRSWTLANGTGVIDIQHPCRSNVAVR
KELHKPASDRSCIHLEFDISGTGLVYETGDHVGVYAENSVQTVEEVERLLDLSPDTFFSI
HADAEDGSPRKGGGSLAPPFPSPCTLRTALLRYADLLNPPKKAALLALASHASDPAEAER
LRFLASPSGKDEYSQWITASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSP
NRMAPSRIHVTCALVYGPSPTGRIHQGVCSTWMKNTIPLEYSEECSWAPIFVRQSNFKLP
ADPSTPIIMIGPGTGLAPFRGFLQERLALKQSGAELGTSILFFGCRNRNMDYIYEDELQT
FLEEGALSELIVAFSREGPTKEYVQHKMVEKATDIWNIISNGGYLYVCGDAKGMARDVHK
MLHTIVQEQGSLDNSKTESYVKSLQMEGRYLRDVW*

MAALEAVRSWAVSVIPPELAAAAGGDPLAALAATAAALVAGLLILAVWFRSGGGAPSKPV
ATPLRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMADEARVRYEKAVFKVVDL
DDYAQEDEEYEEKLKKETVALFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDLKYGI
FGLGNRQYEHFNKVAKVVDELLEEQGGKRLVPVGLGDDDQCIEDDFTAWKELVWPELDQL
LRDEDDTNGASTPYTAAIPEYRVVFIDKSDLSFQDRSWSLANGTGVIDIHHPCRANVAVR
KELHKPASDRSCIHLEFDISGTSLVYETGDHVGVYAENSVETVEEAESLLDLSPDTVFSI
HADAEDGSPRKGGSSLAPPFPSPCTLRTALLRYADLLNPPKKAALLALASHASDPAEAER
LRFLASPAGKDEYSQWITASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPRYYSISSSP
KMAPSRIHVTCALVYGPSPTGRIHQGVCSTWMKNTIPLEYSEECSWAPIFVRQSNFKLPA
DPSTPIIMIGPGTGLAPFRGFLQERLALKQSGAELGTSILFFGCRNRNMDYIYEDELQTF
LEEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISHGGYLYVCGDAKGMARDVHRM
LHTVVQEQGSLDSSKTESYVKSLQMEGRYLRDVW*

Other information
Ka divergence:-0.0487689KaKs divergence:0.236789
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):2088Length 2 (bp):2085Length divergence:-0.001
MFE 1 (kcal):-759.75MFE 2 (kcal):-767.2MFE divergence0.005