Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G086788-GRMZM2G170870
Species:maize
Duplication type:WGD
Function (paralog1):50S ribosomal protein L6
Function (paralog2):50S ribosomal protein L6

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.45347161735214
Log2 mRNA fold difference:-0.7777288093248
Log2 TE fold difference:0.30250264031168
Sequences
Protein sequence

MASISPSLHHPCNSRTGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNV
TLTLEEQFVKAKGPLGELSLSFPGDVKIVKEESGNLRVYKTAETKRANQMHGLFRTLTDN
IIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEENTRITVS
GYDKSAIGQFAATIKKWRPPEPYKGKGIRYMDEVVRRKEGKAGKKK*

MASLSPSLHLPCNSRTGFLGKTRGIRPCVFPAGRVGFVRTVVECKESRIGKQPIEVPSNV
TLTLEEQFVKAKGPLGELSLSFPGDLKIVKEESGNLRVYKTAETKRANQMHGLFRTLTDN
IIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAVKVEENTRIIVS
GYDKSAIGQFAATIKKWRPPEPYKGKGIRYMDEVVRRKEGKAGKKK*

Other information
Ka divergence:-0.5652KaKs divergence:-0.125595
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):681Length 2 (bp):681Length divergence:0
MFE 1 (kcal):-224.5MFE 2 (kcal):-226.6MFE divergence0.005